Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.62
PubTator Score 1.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 1.8e-16
Disease Target Count Z-score Confidence
Mental Depression 333 0.0 1.2
Disease Target Count Z-score Confidence
Premature ovarian failure 65 3.313 1.7
Amenorrhea 58 3.244 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 4.900 1.8e-16

Gene RIF (3)

AA Sequence

MAEHFKQIIRCPVCLKDLEEAVQLKCGYACCLQCLNSLQKEPDGEGLLCRFCSVVSQKDDIKPKYKLRAL      1 - 70
VSIIKELEPKLKSVLTMNPRMRKFQVDMTFDVDTANNYLIISEDLRSFRSGDLSQNRKEQAERFDTALCV     71 - 140
LGTPRFTSGRHYWEVDVGTSQVWDVGVCKESVNRQGKIVLSSEHGFLTVGCREGKVFAASTVPMTPLWVS    141 - 210
PQLHRVGIFLDVGMRSIAFYNVSDGCHIYTFIEIPVCEPWRPFFAHKRGSQDDQSILSICSVINPSAASA    211 - 280
PVSSEGK                                                                   281 - 287
//

Text Mined References (6)

PMID Year Title