Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.34
PubTator Score 1.60

Knowledge Summary

Patent

No data available

Synonym

Accession A6NLU0
Symbols RFPL4
RNF210

Gene

PDB

2FBE  

 GO Function (1)

 Compartment GO Term (1)

Gene RIF (3)

PMID Text
25605732 These results indicate that RFPL4A is a novel factor that increases the G1 population and decreases sensitivity to chemotherapy and thus may be a promising therapeutic target for refractory tumor conditions.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
11850190 The ret finger protein-like 4 gene, Rfpl4, encodes a putative E3 ubiquitin-protein ligase expressed in adult germ cells.

AA Sequence

MAEHFKQIIRCPVCLKDLEEAVQLKCGYACCLQCLNSLQKEPDGEGLLCRFCSVVSQKDDIKPKYKLRAL      1 - 70
VSIIKELEPKLKSVLTMNPRMRKFQVDMTFDVDTANNYLIISEDLRSFRSGDLSQNRKEQAERFDTALCV     71 - 140
LGTPRFTSGRHYWEVDVGTSQVWDVGVCKESVNRQGKIVLSSEHGFLTVGCREGKVFAASTVPMTPLWVS    141 - 210
PQLHRVGIFLDVGMRSIAFYNVSDGCHIYTFIEIPVCEPWRPFFAHKRGSQDDQSILSICSVINPSAASA    211 - 280
PVSSEGK                                                                   281 - 287
//

Text Mined References (6)

PMID Year Title
25605732 2015 RFPL4A increases the G1 population and decreases sensitivity to chemotherapy in human colorectal cancer cells.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16364311 2006 Structure of the PRYSPRY-domain: implications for autoinflammatory diseases.
15057824 2004 The DNA sequence and biology of human chromosome 19.
11850190 2002 The ret finger protein-like 4 gene, Rfpl4, encodes a putative E3 ubiquitin-protein ligase expressed in adult germ cells.