Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.23
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
psoriasis 6694 2.7e-12
Disease Target Count Z-score Confidence
Proliferative vitreoretinopathy 17 3.239 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 2.7e-12

Gene RIF (2)

AA Sequence

MGTPNDQAVLQAIFNPDTPFGDIVGLDLGEEAEKEEREEDEVFPQAQLEQSKALELQGVMAAEAGDLSTA      1 - 70
LERFGQAICLLPERASAYNNRAQARRLQGDVAGALEDLERAVELSGGRGRAARQSFVQRGLLARLQGRDD     71 - 140
DARRDFERAARLGSPFARRQLVLLNPYAALCNRMLADMMGQLRRPRDSR                         141 - 189
//

Text Mined References (6)

PMID Year Title