Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.60
PubTator Score 5.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Diabetes Mellitus, Type 2 142 0.0 0.0
Disease Target Count P-value
adult high grade glioma 3801 1.8e-03
Endometriosis 540 1.1e-02
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 3.0

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma -1.200 1.8e-03
Endometriosis -1.026 1.1e-02

Gene RIF (9)

AA Sequence

MRLLEKLCSSAAGSSAPKPAFAKVLTPNRIPEFCIPPRLPAPCTLESPIRAAAVPRRCAAESDLWPRAAD      1 - 70
EDAGRTDWDPRSQAALSLPHLPRVRTTYGFCALLESPHTRRKESLLLGGPPAPRPRAHSCGGGGGPDAPL     71 - 140
GTLCGPRGPGPATPAAPGGPRLPQDALAAGPRRCRLLRVPDGLLSRALRAGRSRRLARVRSVSSGNEDEE    141 - 210
RRAGSESPARAPSSSPLSSRAPLPERLEAKGTVALGRAGDALRLAAEYCPGTRRLRLRLLRAESLFGGAP    211 - 280
GPRAVRCRLSLVLRPPGTARWQCSAVVGRSRKASFDQDFCFDGLSEDEVRRLAVRVKARDEGRGRDRGRL    281 - 350
LGQGELSLGALLLL                                                            351 - 364
//

Text Mined References (17)

PMID Year Title