Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.60
PubTator Score 5.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma -1.200 0.002
Endometriosis -1.026 0.011

Synonym

Accession A6NLJ0
Symbols NLF2
FAM148B

Gene

Gene RIF (8)

PMID Text
22885067 Loss of NLF2 gene expression in the endometrium of patients with implantation failure after in vitro ertilization treatment.
20818381 Single nucleotide polymorphism in C2CD4B is associated with type 2 diabetes.
20818381 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20419449 Observational study of gene-disease association. (HuGE Navigator)
20185807 Observational study of gene-disease association. (HuGE Navigator)
20081858 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
15527968 NLF2 may play a role in regulating genes which control cellular architecture.

AA Sequence

MRLLEKLCSSAAGSSAPKPAFAKVLTPNRIPEFCIPPRLPAPCTLESPIRAAAVPRRCAAESDLWPRAAD      1 - 70
EDAGRTDWDPRSQAALSLPHLPRVRTTYGFCALLESPHTRRKESLLLGGPPAPRPRAHSCGGGGGPDAPL     71 - 140
GTLCGPRGPGPATPAAPGGPRLPQDALAAGPRRCRLLRVPDGLLSRALRAGRSRRLARVRSVSSGNEDEE    141 - 210
RRAGSESPARAPSSSPLSSRAPLPERLEAKGTVALGRAGDALRLAAEYCPGTRRLRLRLLRAESLFGGAP    211 - 280
GPRAVRCRLSLVLRPPGTARWQCSAVVGRSRKASFDQDFCFDGLSEDEVRRLAVRVKARDEGRGRDRGRL    281 - 350
LGQGELSLGALLLL                                                            351 - 364
//

Text Mined References (16)

PMID Year Title
23945395 2014 Genome-wide association study identifies three novel loci for type 2 diabetes.
22885067 2012 NLF2 gene expression in the endometrium of patients with implantation failure after IVF treatment.
21873549 2011 Genome-wide association identifies nine common variants associated with fasting proinsulin levels and provides new insights into the pathophysiology of type 2 diabetes.
21799836 2011 A genome-wide association study confirms previously reported loci for type 2 diabetes in Han Chinese.
20862305 2010 Identification of new genetic risk variants for type 2 diabetes.
20818381 2010 A genome-wide association study in the Japanese population identifies susceptibility loci for type 2 diabetes at UBE2E2 and C2CD4A-C2CD4B.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20419449 2010 Variants at DGKB/TMEM195, ADRA2A, GLIS3 and C2CD4B loci are associated with reduced glucose-stimulated beta cell function in middle-aged Danish people.
20185807 2010 Detailed physiologic characterization reveals diverse mechanisms for novel genetic Loci regulating glucose and insulin metabolism in humans.
20081858 2010 New genetic loci implicated in fasting glucose homeostasis and their impact on type 2 diabetes risk.
More...