Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NLF2
Symbols ELOA3L2
TCEB3CL2

Gene

PANTHER Protein Class (1)

AA Sequence

MAAGSTTLRAVGKLQVRLATKTEPKKLEKYLQKLSALPMTADILAETGIRKTVKRLRKHQHVGDFARDLA      1 - 70
ARWKKLVLVDRNTGPDPQDPEESASRQRFGEALQEREKAWGFPENATAPRSPSHSPEHRRTARRTPPGQQ     71 - 140
RPHPRSPSREPRAERKRPRMAPADSGPHRDPPTRTAPLPMPEGPEPAVPGEQPGRGHAHAAQGGPLLGQG    141 - 210
CQGQPQGEAVGSHSKGHKSSRGASAQKSPPVQESQSERLQAAVADSAGPKTVPSHVFSELWDPSEAWMQA    211 - 280
NYDLLSAFEAMTSQANPEALSAPTLQEEAAFPGRRVNAKMPVYSGSRPACQLQVPTLRQQCLRVPRNNPD    281 - 350
ALGDVEGVPYSALEPVLEGWTPDQPYRTEKDNAALARETDELWRIHCLQDFKEEKPQEHESWRELYLRLR    351 - 420
DAREQRLRVVTTKIRSARENKPSGRQTKMICFNSVAKTPYDASRRQEKSAGAADPGNGEMEPAPKPAGSS    421 - 490
QAPSGLGDGDGGSVSGGGSSNRHAAPADKTRKQAAKKVAPLMAKAIRDYKGRFSRR                  491 - 546
//

Text Mined References (1)

PMID Year Title
16177791 2005 DNA sequence and analysis of human chromosome 18.