Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.14
PubTator Score 1.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Acquired metabolic disease 267 2.0

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MATQQVDSRRQVAAEQVAAQLLERRRGSHCDDEKQTLLALLILVLYLSTEIWGSSWEVSERIRECNYYQN      1 - 70
LAVPQGLEYQTNEPSEEPIKTIRNWLKEKLHVFSEKLEEEVQQLEQLAWDLELWLDALLGEPHQEEHCST     71 - 140
YKSHLWEWAWALGREHKGGEGLLEISLSGAEL                                          141 - 172
//

Text Mined References (6)

PMID Year Title
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
23028347 2012 A genome-wide association study identifies five loci influencing facial morphology in Europeans.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19197348 2009 Genome-wide association studies in an isolated founder population from the Pacific Island of Kosrae.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.