Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.14
PubTator Score 1.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0

Gene RIF (1)

AA Sequence

MATQQVDSRRQVAAEQVAAQLLERRRGSHCDDEKQTLLALLILVLYLSTEIWGSSWEVSERIRECNYYQN      1 - 70
LAVPQGLEYQTNEPSEEPIKTIRNWLKEKLHVFSEKLEEEVQQLEQLAWDLELWLDALLGEPHQEEHCST     71 - 140
YKSHLWEWAWALGREHKGGEGLLEISLSGAEL                                          141 - 172
//

Text Mined References (6)

PMID Year Title