Knowledge Summary

Patent

No data available

Synonym

Accession A6NLC8
Symbols

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

METGRQTGVSAEMFAMPRDLKGSKKDGIPEDLDGNLEEPRDQEGELRSEDVMDLTEGDNEASASAPPAAK      1 - 70
RRKTDTKGKKERKPTVDAEEAQRMTTLLSAMSEEQLSRYEVCRRSAFPKACIAGLMRSITGRSVSENVAI     71 - 140
AMAGIAKVFVGEVVEEALDVCEMWGEMPPLQPKHLREAVRRLKPKGLFPNSNYKKIMF                141 - 198
//

Text Mined References (1)

PMID Year Title
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.