Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.69701362908137E-8
atypical teratoid / rhabdoid tumor 4369 2.37425242088482E-6
sonic hedgehog group medulloblastoma 1482 8.10316901458305E-5
pilocytic astrocytoma 3086 2.16173243771008E-4
pituitary cancer 1972 0.00170100640896516
medulloblastoma, large-cell 6234 0.00635815147332341
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0127538977585657
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0212773168818482
Breast cancer 3099 0.0289276581712688
subependymal giant cell astrocytoma 2287 0.0311192473514797
Disease Target Count Z-score Confidence
Malaria 140 0.0 1.0

Expression

Synonym

Accession A6NLC5 B2RNY2 B9EH83
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Xenopus OMA EggNOG Inparanoid

 Compartment GO Term (2)

AA Sequence

MSAAASPASERGWKSEKLDEAQALARSCAARRPDFQPCDGLSICATHSHGKCFKLHWCCHLGWCHCKYMY      1 - 70
QPMTPVEQLPSTEIPARPREPTNTIQISVSLTEHFLKFASVFQPPLPPDSPRYCMISDLFIDNYQVKCIN     71 - 140
GKMCYVQKQPAPHSHRMSPEEVSAHDALISKESNTPKIDHCSSPSSSEDSGINAIGAHYVESCDEDTEEG    141 - 210
AELSSEEDYSPESSWEPDECTLLSPSQSDLEVIETIETTV                                  211 - 250
//

Text Mined References (4)

PMID Year Title
21042317 2012 Genome-wide association study of major depressive disorder: new results, meta-analysis, and lessons learned.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.