Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A6NLC5 B2RNY2 B9EH83
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MSAAASPASERGWKSEKLDEAQALARSCAARRPDFQPCDGLSICATHSHGKCFKLHWCCHLGWCHCKYMY      1 - 70
QPMTPVEQLPSTEIPARPREPTNTIQISVSLTEHFLKFASVFQPPLPPDSPRYCMISDLFIDNYQVKCIN     71 - 140
GKMCYVQKQPAPHSHRMSPEEVSAHDALISKESNTPKIDHCSSPSSSEDSGINAIGAHYVESCDEDTEEG    141 - 210
AELSSEEDYSPESSWEPDECTLLSPSQSDLEVIETIETTV                                  211 - 250
//

Text Mined References (4)

PMID Year Title
21042317 2012 Genome-wide association study of major depressive disorder: new results, meta-analysis, and lessons learned.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.