Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.50
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.200 4.7e-04
atypical teratoid / rhabdoid tumor -1.500 6.5e-08
ependymoma -1.600 4.6e-15
glioblastoma -1.200 3.9e-03
group 3 medulloblastoma -1.700 2.4e-04
medulloblastoma, large-cell -1.400 6.2e-04
osteosarcoma -1.147 1.2e-03

AA Sequence

MPALLLLVLLASSAGQARARPSNATSAEPAGPLPALLAHLRRLTGALTGGGGAASPGANGTRTGPAGGAG      1 - 70
AAARAPPPAELCHGYYDVMGQYDATFNCSTGSYRFCCGTCHYRFCCEHRHMRLAQASCSNYDTPRWATTP     71 - 140
PPLAGGAGGAGGAGGGPGPGQAGWLEGGRTGGAGGRGGEGPGGSTAYVVCGVISFALAVGVGAKVAFSKA    141 - 210
SRAPRAHRDINVPRALVDILRHQAGPGTRPDRARSSSLTPGIGGPDSMPPRTPKNLYNTVKTPNLDWRAL    211 - 280
PPPSPSLHYSTLSCSRSFHNLSHLPPSYEAAVKSELNRYSSLKRLAEKDLDEAYLKRRPLELPRGTLPLH    281 - 350
ALRRPGTGGGYRMEAWGGPEELGLAPAPNPRRVMSQEHLLGDGGRSRYEFTLPRARLVSQEHLLLSSPEA    351 - 420
LRQSREHLLSPPRSPALPPDPTARASLAASHSNLLLGPGGPPTPLRGLPPPSSLHAHHHHALHGSPQPAW    421 - 490
MSDAGGGGGTLARRPPFQRQGTLEQLQFIPGHHLPQHLRTASKNEVTV                          491 - 538
//

Text Mined References (4)

PMID Year Title