Knowledge Summary

Patent

No data available

Synonym

Accession A6NL46
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MRLCLIPWNTTPHRVLPPVVWSAPSRKKPVLSARNSMMFGHLSPVRNPRLRGKFNLQLPSLDEQVIPTRL      1 - 70
PKMEVRAEEPKEATEVKDQVETQGQEDNKTGPCSNGKAASTSRPLETQGNLTSSWYNPRPLEGNVHLKSL     71 - 140
TEKNQTDKAQVHAVSFYSKGHGVTSSHSPAGGILPFGKPDPLPAVLPAPVPDCSLWPEKAALKVLGKDHL    141 - 210
PSSPGLLMVGEDMQPKDPAALRSSRSSPPRAAGHRPRKRKLSGPPLQLQQTPPLQLRWDRDEGPPPAKLP    211 - 280
CLSPEALLVGKASQREGRLQQGNMRKNVRVLSRTSKFRRLRQLLRRRKKRWQGRRGGSRL              281 - 340
//

Text Mined References (1)

PMID Year Title
14574404 2003 The DNA sequence and analysis of human chromosome 6.