Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NKX1
Symbols CXorf52
CXorf52B
LINC00204B
NCRNA00204B

Gene

 Compartment GO Term (0)

AA Sequence

MYVQEHRLWGLMDKPHSAPCLMSLSLSFLICNKGRNAIRVQQSTDERMDAMLLRQCPTQGTRKNHESNSS      1 - 70
LHHVPNWIFHSTIIPPNKGSKRCLRKVDWLLPRAGGVGGKRGVTADGDRVSF                       71 - 122
//

Text Mined References (2)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15772651 2005 The DNA sequence of the human X chromosome.