Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.14
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MSEASRLCSGYYSLNQSFVEPFQCPRRGEGAALQYCCGFADLKYCCSEPGSYFPYKHSYMWSLSIGALIG      1 - 70
LGIAALVLLAFVISVCVLCYLFLYTKPQRLDTGLKLQHLEASSTQEGKSNGKTKALNSNAASNATNETYY     71 - 140
EADDIIQEKTMDATQIHIAY                                                      141 - 160
//

Text Mined References (1)

PMID Year Title
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.