Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.00
PubTator Score 2.17

Knowledge Summary

Patent

No data available

Gene RIF (2)

AA Sequence

MSTFPVLAEDIPLRERHVKGRVDPHFRAPKMEMFQRLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEK      1 - 70
EGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQC     71 - 140
ALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGP                           141 - 187
//

Text Mined References (20)

PMID Year Title