Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.45
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.25825776665598E-49
posterior fossa group A ependymoma 1511 1.03758191707113E-18
atypical teratoid / rhabdoid tumor 4369 8.63419464141192E-11
glioblastoma 5572 3.42887834988628E-10
pilocytic astrocytoma 3086 1.05964496270453E-9
medulloblastoma 1524 4.22117805876774E-9
pediatric high grade glioma 2712 2.4446813111789E-8
medulloblastoma, large-cell 6234 1.61548004870811E-7
nasopharyngeal carcinoma 1056 5.33611543573221E-6
interstitial cystitis 2299 5.38345363102082E-6
pituitary cancer 1972 1.25505740456239E-5
astrocytic glioma 2241 0.00420512296531192
lung adenocarcinoma 2714 0.00599405749141883
oligodendroglioma 2849 0.0082022258447604
primitive neuroectodermal tumor 3031 0.0247684276948223

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -2.700 0.004
posterior fossa group A ependymoma -3.900 0.000
oligodendroglioma -2.400 0.008
glioblastoma -4.400 0.000
medulloblastoma -4.100 0.000
atypical teratoid / rhabdoid tumor -4.200 0.000
medulloblastoma, large-cell -4.300 0.000
primitive neuroectodermal tumor -2.600 0.025
interstitial cystitis -3.900 0.000
pediatric high grade glioma -3.500 0.000
pilocytic astrocytoma -3.300 0.000
psoriasis 1.800 0.000
lung adenocarcinoma 1.500 0.006
nasopharyngeal carcinoma -1.400 0.000
pituitary cancer -4.600 0.000

Gene RIF (1)

PMID Text
15053978 Cloning and expression analysis of the mouse Pcp4l1 gene, and sequence comparison to human PCP4L1.

AA Sequence

MSELNTKTSPATNQAAGQEEKGKAGNVKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQKRKKDPSS        1 - 68
//

Text Mined References (7)

PMID Year Title
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
19284880 2009 Identification of candidate genes for human pituitary development by EST analysis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15053978 2004 Pcp4l1, a novel gene encoding a Pcp4-like polypeptide, is expressed in specific domains of the developing brain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.