Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.45
PubTator Score 0.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -2.700 0.004
posterior fossa group A ependymoma -3.900 0.000
oligodendroglioma -2.400 0.008
glioblastoma -4.400 0.000
medulloblastoma -4.100 0.000
atypical teratoid / rhabdoid tumor -4.200 0.000
medulloblastoma, large-cell -4.300 0.000
primitive neuroectodermal tumor -2.600 0.025
interstitial cystitis -3.900 0.000
pediatric high grade glioma -3.500 0.000
pilocytic astrocytoma -3.300 0.000
psoriasis 1.800 0.000
lung adenocarcinoma 1.500 0.006
nasopharyngeal carcinoma -1.400 0.000
pituitary cancer -4.600 0.000

Synonym

Accession A6NKN8 B2RV24 B9EJG4 PCP4-like protein 1
Symbols IQM1

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
15053978 Cloning and expression analysis of the mouse Pcp4l1 gene, and sequence comparison to human PCP4L1.

AA Sequence

MSELNTKTSPATNQAAGQEEKGKAGNVKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQKRKKDPSS        1 - 68
//

Text Mined References (7)

PMID Year Title
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
19284880 2009 Identification of candidate genes for human pituitary development by EST analysis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15053978 2004 Pcp4l1, a novel gene encoding a Pcp4-like polypeptide, is expressed in specific domains of the developing brain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.