Property Summary

NCBI Gene PubMed Count 2
Grant Count 1
Funding $92,688
PubMed Score 24.23
PubTator Score 5.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
medulloblastoma, large-cell -1.600 0.014
adrenocortical carcinoma -1.437 0.000
group 3 medulloblastoma -1.500 0.028
pilocytic astrocytoma 1.600 0.000
Breast cancer -1.400 0.000
pituitary cancer -1.600 0.000

AA Sequence

MIATGGLLRISARKQDPLRPPSQIPKRKRKAKKRRKNDVVVVKGKLKLCSISGLIALCGILVLLVGIAMA      1 - 70
VVGYWPKATGTNREGGKQLPPAGSSHRVPTTANSSSSGSKNRSRSHPRAPGGVNSSSAGAPRSTPPARAA     71 - 140
SPSSSSTSVGFFFRIFSGYLHSDKLKVFGPLIMGIGIFLFICANAVLHENRDKKTKIINLRDLYSTVIDV    141 - 210
HSLRAKDLAAAAAAAAAAAASSSSSAPAAAPPGAIPLNGFLSYVQSRGLELKPGGCGGSGDAFGAAAMLA    211 - 280
KGSWPPHPAAPSGGRPRGAASPPDLASSPRCPREPPSLAEAVYSVYRERSGVAGSRRAAAATAAAAASSC    281 - 350
SSPAPCSPPESWGRQSTASSFVDSSLSAFALLPLQGGRDRGGDAEGASCSWQRPPGERGSQEIPRGELDL    351 - 420
SMTNLRGAEGSMRGARREPEEPEGAVAARAARGQGGRLPRTGRYAALRRRSTSGLPDYRAPPSPEPPPSP    421 - 490
GSADPDSSPLAKAASPSPPLRLEGSPPTRRDSGSSQSDDPSSSNKGYTPLREAGTSTESVLDAVAGQTRD    491 - 560
SAVAAPVLGAEQSSPEGASQEPPTAEQPQPVQRQFTNKEKLIMISRSHAIGVEEELESTGI             561 - 621
//

Text Mined References (2)

PMID Year Title
16177791 2005 DNA sequence and analysis of human chromosome 18.
15722956 2005 Candidate psychiatric illness genes identified in patients with pericentric inversions of chromosome 18.