Property Summary

NCBI Gene PubMed Count 2
PubMed Score 25.05
PubTator Score 5.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
adrenocortical carcinoma -1.437 8.0e-05
Astrocytoma, Pilocytic 1.600 3.7e-05
Breast cancer -1.400 2.0e-04
group 3 medulloblastoma -1.500 2.8e-02
medulloblastoma, large-cell -1.600 1.4e-02
pituitary cancer -1.600 4.9e-04

AA Sequence

MIATGGLLRISARKQDPLRPPSQIPKRKRKAKKRRKNDVVVVKGKLKLCSISGLIALCGILVLLVGIAMA      1 - 70
VVGYWPKATGTNREGGKQLPPAGSSHRVPTTANSSSSGSKNRSRSHPRAPGGVNSSSAGAPRSTPPARAA     71 - 140
SPSSSSTSVGFFFRIFSGYLHSDKLKVFGPLIMGIGIFLFICANAVLHENRDKKTKIINLRDLYSTVIDV    141 - 210
HSLRAKDLAAAAAAAAAAAASSSSSAPAAAPPGAIPLNGFLSYVQSRGLELKPGGCGGSGDAFGAAAMLA    211 - 280
KGSWPPHPAAPSGGRPRGAASPPDLASSPRCPREPPSLAEAVYSVYRERSGVAGSRRAAAATAAAAASSC    281 - 350
SSPAPCSPPESWGRQSTASSFVDSSLSAFALLPLQGGRDRGGDAEGASCSWQRPPGERGSQEIPRGELDL    351 - 420
SMTNLRGAEGSMRGARREPEEPEGAVAARAARGQGGRLPRTGRYAALRRRSTSGLPDYRAPPSPEPPPSP    421 - 490
GSADPDSSPLAKAASPSPPLRLEGSPPTRRDSGSSQSDDPSSSNKGYTPLREAGTSTESVLDAVAGQTRD    491 - 560
SAVAAPVLGAEQSSPEGASQEPPTAEQPQPVQRQFTNKEKLIMISRSHAIGVEEELESTGI             561 - 621
//

Text Mined References (2)

PMID Year Title