Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent (51)

AA Sequence

MEEENATLLTEFVLTGFLYQPQWKIPLFLAFLVIYLITIMGNLGLIAVIWKDPHLHIPMYLLLGNLAFVD      1 - 70
AWISSTVTPKMLNNFLAKSKMISLSECKIQFFSFAISVTTECFLLATMAYDRYVAICKPLLYPAIMTNGL     71 - 140
CIRLLILSYVGGILHALIHEGFLFRLTFCNSNIVHHIYCDTIPLSKISCTDSSINFLMVFIFSGSIQVFS    141 - 210
IVTILVSYTFVLFAILKKKSDKGVRKAFSTCGAHLFSVSLYYGPLLFIYVGPASPQADDQDMVEPLFYTV    211 - 280
IIPLLNPIIYSLRNKQVTVSFTKMLKKHVKVSY                                         281 - 313
//

Text Mined References (2)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
1370859 1992 Expression of members of the putative olfactory receptor gene family in mammalian germ cells.