Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MAKCTKKVGGIVSKYRTHHGASLWKMVKEIEISQHTKYTCSFCGKTKMKRRAVKIRHCNSCMKTVAGSAW      1 - 70
TYNTTSAVMVKSAIRRLKELKDQ                                                    71 - 93
//

Text Mined References (3)

PMID Year Title