Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.46
PubTator Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 0.000

Gene RIF (1)

PMID Text
21955986 this report introduces Brightlike as an additional functional member of the family of ARID proteins, which should be considered in regulatory circuits, previously ascribed to be mediated by Bright.[ARID3C]

AA Sequence

MEALQKQQAARLAQGVGPLAPACPLLPPQPPLPDHRTLQAPEGALGNVGAEEEEDAEEDEEKREEAGAEE      1 - 70
EAAEESRPGAQGPSSPSSQPPGLHPHEWTYEEQFKQLYELDADPKRKEFLDDLFSFMQKRGTPVNRVPIM     71 - 140
AKQVLDLYALFRLVTAKGGLVEVINRKVWREVTRGLSLPTTITSAAFTLRTQYMKYLYPYECETRALSSP    141 - 210
GELQAAIDSNRREGRRQAYTATPLFGLAGPPPRGAQDPALGPGPAPPATQSSPGPAQGSTSGLPAHACAQ    211 - 280
LSPSPIKKEESGIPNPCLALPVGLALGPTREKLAPEEPPEKRAVLMGPMDPPRPCMPPSFLPRGKVPLRE    281 - 350
ERLDGPLNLAGSGISSINMALEINGVVYTGVLFARRQPVPASQGPTNPAPPPSTGPPSSILP            351 - 412
//

Text Mined References (6)

PMID Year Title
21955986 2011 Characterization of a new ARID family transcription factor (Brightlike/ARID3C) that co-activates Bright/ARID3A-mediated immunoglobulin gene transcription.
17400556 2007 REKLES is an ARID3-restricted multifunctional domain.
15922553 2005 Nomenclature of the ARID family of DNA-binding proteins.
15164053 2004 DNA sequence and analysis of human chromosome 9.
11959810 2002 ARID proteins: a diverse family of DNA binding proteins implicated in the control of cell growth, differentiation, and development.
10838570 2000 ARID proteins come in from the desert.