Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.91
PubTator Score 2.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.0
Disease Target Count Z-score Confidence
Colon adenoma 6 3.909 2.0

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 1.100 1.3e-02
Breast cancer 3.800 3.4e-02
facioscapulohumeral dystrophy 1.300 6.5e-03
lung adenocarcinoma 1.500 1.3e-11
lung cancer 1.600 3.7e-05
malignant mesothelioma 1.200 2.6e-06
non-small cell lung cancer 1.252 2.9e-18
ovarian cancer 3.400 5.8e-08
pancreatic cancer 1.100 5.6e-03
pancreatic carcinoma 1.100 5.6e-03
tuberculosis 1.400 1.1e-03

Gene RIF (1)

AA Sequence

MAGRRAQTGSAPPRPAAPHPRPASRAFPQHCRPRDAERPPSPRSPLMPGCELPVGTCPDMCPAAERAQRE      1 - 70
REHRLHRLEVVPGCRQDPPRADPQRAVKEYSRPAAGKPRPPPSQLRPPSVLLATVRYLAGEVAESADIAR     71 - 140
AEVASFVADRLRAVLLDLALQGAGDAEAAVVLEAALATLLTVVARLGPDAARGPADPVLLQAQVQEGFGS    141 - 210
LRRCYARGAGPHPRQPAFQGLFLLYNLGSVEALHEVLQLPAALRACPPLRKALAVDAAFREGNAARLFRL    211 - 280
LQTLPYLPSCAVQCHVGHARREALARFARAFSTPKGQTLPLGFMVNLLALDGLREARDLCQAHGLPLDGE    281 - 350
ERVVFLRGRYVEEGLPPASTCKVLVESKLRGRTLEEVVMAEEEDEGTDRPGSPA                    351 - 404
//

Text Mined References (16)

PMID Year Title