Property Summary

NCBI Gene PubMed Count 9
Grant Count 4
R01 Count 4
Funding $484,463.66
PubMed Score 5.91
PubTator Score 2.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
pancreatic cancer 1.100 0.006
malignant mesothelioma 1.200 0.000
astrocytoma 1.100 0.013
tuberculosis 1.400 0.001
non-small cell lung cancer 1.252 0.000
lung cancer 1.600 0.000
Breast cancer 3.800 0.034
pancreatic carcinoma 1.100 0.006
lung adenocarcinoma 1.500 0.000
ovarian cancer 3.400 0.000
facioscapulohumeral dystrophy 1.300 0.007

Synonym

Accession A6NKF1 A8MX08 Q99773
Symbols SHD1
HSU79266

Gene

Gene RIF (1)

PMID Text
18838617 SHD1 is a novel cytokine-inducible negative feedback regulator of STAT5a.

AA Sequence

MAGRRAQTGSAPPRPAAPHPRPASRAFPQHCRPRDAERPPSPRSPLMPGCELPVGTCPDMCPAAERAQRE      1 - 70
REHRLHRLEVVPGCRQDPPRADPQRAVKEYSRPAAGKPRPPPSQLRPPSVLLATVRYLAGEVAESADIAR     71 - 140
AEVASFVADRLRAVLLDLALQGAGDAEAAVVLEAALATLLTVVARLGPDAARGPADPVLLQAQVQEGFGS    141 - 210
LRRCYARGAGPHPRQPAFQGLFLLYNLGSVEALHEVLQLPAALRACPPLRKALAVDAAFREGNAARLFRL    211 - 280
LQTLPYLPSCAVQCHVGHARREALARFARAFSTPKGQTLPLGFMVNLLALDGLREARDLCQAHGLPLDGE    281 - 350
ERVVFLRGRYVEEGLPPASTCKVLVESKLRGRTLEEVVMAEEEDEGTDRPGSPA                    351 - 404
//

Text Mined References (16)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18838617 2009 SHD1 is a novel cytokine-inducible, negative feedback regulator of STAT5-dependent transcription.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16239144 2005 Integrator, a multiprotein mediator of small nuclear RNA processing, associates with the C-terminal repeat of RNA polymerase II.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...