Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.35
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Astrocytoma, Pilocytic -1.200 7.8e-05
glioblastoma -1.100 1.1e-02
group 4 medulloblastoma -1.400 5.0e-04
intraductal papillary-mucinous neoplasm ... 1.100 1.4e-02
osteosarcoma -1.177 8.8e-03
ovarian cancer -1.200 9.6e-04
pancreatic ductal adenocarcinoma liver m... -1.069 3.6e-02
psoriasis 1.400 3.3e-16
spina bifida -1.283 4.9e-02
subependymal giant cell astrocytoma -1.346 2.4e-02

Gene RIF (1)

AA Sequence

MAKPAATAAAASEELSQVPDEELLRWSKEELARRLRRAEGEKVGLMLEHGGLMRDVNRRLQQHLLEIRGL      1 - 70
KDVNQRLQDDNQELRELCCFLDDDRQKGRKLAREWQRFGRHAAGAVWHEVARSQQKLRELEARQEALLRE     71 - 140
NLELKELVLLLDEERAALAATGAASGGGGGGGGAGSRSSIDSQASLSGPLSGGAPGAGARDVGDGSSTSS    141 - 210
AGSGGSPDHHHHVPPPLLPPGPHKAPDGKAGATRRSLDDLSAPPHHRSIPNGLHDPSSTYIRQLESKVRL    211 - 280
LEGDKLLAQQAGSGEFRTLRKGFSPYHSESQLASLPPSYQDSLQNGPACPAPELPSPPSAGYSPAGQKPE    281 - 350
AVVHAMKVLEVHENLDRQLQDSCEEDLSEKEKAIVREMCNVVWRKLGDAASSKPSIRQHLSGNQFKGPL     351 - 419
//

Text Mined References (14)

PMID Year Title