Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.28
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.177 0.009
glioblastoma -1.100 0.011
pancreatic ductal adenocarcinoma liver m... -1.069 0.036
intraductal papillary-mucinous neoplasm ... 1.100 0.014
group 4 medulloblastoma -1.400 0.001
pilocytic astrocytoma -1.200 0.000
subependymal giant cell astrocytoma -1.346 0.024
psoriasis 1.400 0.000
spina bifida -1.283 0.049
ovarian cancer -1.200 0.001

Gene RIF (1)

PMID Text
25649651 Genome-wide SNP analysis identified multiple suggestive novel loci and two of them were also significant in gene-based analysis (CCDC85C and NARS2) that survived after controlling for false-discovery rate at 0.05.

AA Sequence

MAKPAATAAAASEELSQVPDEELLRWSKEELARRLRRAEGEKVGLMLEHGGLMRDVNRRLQQHLLEIRGL      1 - 70
KDVNQRLQDDNQELRELCCFLDDDRQKGRKLAREWQRFGRHAAGAVWHEVARSQQKLRELEARQEALLRE     71 - 140
NLELKELVLLLDEERAALAATGAASGGGGGGGGAGSRSSIDSQASLSGPLSGGAPGAGARDVGDGSSTSS    141 - 210
AGSGGSPDHHHHVPPPLLPPGPHKAPDGKAGATRRSLDDLSAPPHHRSIPNGLHDPSSTYIRQLESKVRL    211 - 280
LEGDKLLAQQAGSGEFRTLRKGFSPYHSESQLASLPPSYQDSLQNGPACPAPELPSPPSAGYSPAGQKPE    281 - 350
AVVHAMKVLEVHENLDRQLQDSCEEDLSEKEKAIVREMCNVVWRKLGDAASSKPSIRQHLSGNQFKGPL     351 - 419
//

Text Mined References (12)

PMID Year Title
25649651 2015 Genetic Determinants of Survival in Patientswith Alzheimer’s Disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
More...