Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.54
PubTator Score 1.50

Knowledge Summary

Patent

No data available

AA Sequence

MRPEGSLTYRVPERLRQGSCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDI      1 - 70
MAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERR     71 - 140
RKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHRVHLCKIMLFFRSNPY    141 - 210
FQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDL    211 - 280
WRNPLQYYKRMKPPEEGTETSGDSQLLS                                              281 - 308
//

Text Mined References (3)

PMID Year Title
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10773691 2000 Characterization of a new TSPY gene family member in Yq (TSPYq1).