Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A6NKC9
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MEDSLKQLSLGRDPEGAGDSQALAELQELALKWFMETQAPFILQNGALPPWFHGFITRKQTEQLLRDKAL      1 - 70
GSFLIRLSDRATGYILSYRGSDRCRHFVINQLRNRRYIISGDTQSHSTLAELVHHYQEAQLEPFKEMLTA     71 - 140
ACPRPEDNDLYDAITRGLHQTIVDPENPPATAFLTVVPDKAASPRSSPKPQVSFLHAQKSLDVSPRNLSQ    141 - 210
EESMEAPIRVSPLPEKSSSLLEESFGGPSDIIYADLRRMNQARLGLGTEGSGRHGPVPAGSQAYSPGREA    211 - 280
QRRLSDGEQNRPDGLGPVLSGVSPDQGPTESPTSWGCSDAMGSLGATWRQEFPKLSQEAQPCSQGSSADI    281 - 350
YEFIGTEGLLQEARDTPDQEGSTYEQIPACWGGPARAPHPGASPTYSPWVHGYKRISGTPELSEPGNTYE    351 - 420
QIPATKSKETGRTHKPDKLRRLFFTYRKHKF                                           421 - 451
//

Text Mined References (2)

PMID Year Title
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
11181995 2001 The sequence of the human genome.