Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00
PubTator Score 18.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 3.100 0.004
cystic fibrosis 1.600 0.011
Breast cancer -2.000 0.001
breast carcinoma -1.500 0.000
gastric carcinoma -2.100 0.017
ovarian cancer 2.000 0.004

Gene RIF (10)

PMID Text
26701853 Loss of RASSF10 expression is associated with hepatocellular carcinoma.
26645898 Since restoration of RASSF10 expression sensitized breast cancer cells to docetaxel, RASSF10 methylation is a potential docetaxel resistant marker. RASSF10 suppresses breast cancer growth by activating P53 signaling.
24759621 RASSF10 was frequently methylated in human esophageal squamous cell carcinoma and expression of RASSF10 was regulated by promoter region hypermethylation. RASSF10 may serve as a tumor suppressor of esophageal cancer
24573726 RASSF10 is an epigenetically silenced gene involved in tumor invasion and metastasis in gastric cancer
23428420 the results of this study provide insight into the role of RASSF10 as a novel functional tumor suppressor in gastric cancer through inhibition of the Wnt/beta-catenin signaling pathway.
22415519 The study demonstrates the frequent epigenetic inactivation of RASSF10 in PCa and its implication in clinical symptoms of PCa.
22113481 The RASSF10 promoter was hypermethylated in all malignant melanoma (MM) cell lines, 19/28 of the primary MM, 30/33 of the MM metastases, 2/18 of the dysplastic nevus cell nevi, and 0/29 of the non-dysplastic nevus cell nevi.
20956940 This is the first report demonstrating that RASSF10 can act as a tumor suppressor gene and is frequently methylated in gliomas
19934646 RASSF10 may encode a novel epigenetically inactivated candidate tumor suppressor gene in thyroid carcinogenesis.
19570220 Sequencing revealed RASSF6 and RASSF10 were the only RASSF members with a high frequency of leukaemia-specific methylation.

AA Sequence

MDPSEKKISVWICQEEKLVSGLSRRTTCSDVVRVLLEDGCRRRRRQRRSRRLGSAGDPHGPGELPEPPNE      1 - 70
DDEDDDEALPQGMLCGPPQCYCIVEKWRGFERILPNKTRILRLWAAWGEEQENVRFVLVRSEASLPNAGP     71 - 140
RSAEARVVLSRERPCPARGAPARPSLAMTQEKQRRVVRKAFRKLAKLNRRRQQQTPSSCSSTSSSTASSC    141 - 210
SSSPRTHESASVERMETLVHLVLSQDHTIRQQVQRLHELDREIDHYEAKVHLDRMRRHGVNYVQDTYLVG    211 - 280
AGIELDGSRPGEEPEEVAAEAEEAAAAPPLAGEAQAAALEELARRCDDLLRLQEQRVQQEELLERLSAEI    281 - 350
QEELNQRWMRRRQEELAAREEPLEPDGGPDGELLLEQERVRTQLSTSLYIGLRLNTDLEAVKSDLDYSQQ    351 - 420
QWDSKKRELQGLLQTLHTLELTVAPDGAPGSGSPSREPGPQACADMWVDQARGLAKSGPGNDEDSDTGLS    421 - 490
SMHSQDSDSLPMCESLV                                                         491 - 507
//

Text Mined References (13)

PMID Year Title
26701853 2016 RASSF10 is an epigenetically inactivated tumor suppressor and independent prognostic factor in hepatocellular carcinoma.
26645898 2015 Methylation of RASSF10 promotes cell proliferation and serves as a docetaxel resistant marker in human breast cancer.
24759621 2014 Epigenetic silencing of RASSF10 promotes tumor growth in esophageal squamous cell carcinoma.
24573726 2014 RASSF10 is an epigenetically silenced tumor suppressor in gastric cancer.
23428420 2013 RASSF10 is epigenetically silenced and functions as a tumor suppressor in gastric cancer.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22415519 2012 Epigenetic down regulation of RASSF10 and its possible clinical implication in prostate carcinoma.
22113481 2012 RASSF10 promoter hypermethylation is frequent in malignant melanoma of the skin but uncommon in nevus cell nevi.
20956940 2011 Epigenetic inactivation of the RASSF10 candidate tumor suppressor gene is a frequent and an early event in gliomagenesis.
19934646 2009 Frequent epigenetic inactivation of RASSF10 in thyroid cancer.
More...