Property Summary

NCBI Gene PubMed Count 4
PubMed Score 25.64
PubTator Score 8.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
non diabetic and post-ischemic heart fai... 1.800 0.017
medulloblastoma, large-cell 1.100 0.001
adult high grade glioma 1.100 0.002
lung carcinoma -1.400 0.001
ovarian cancer 1.200 0.000

AA Sequence

MDNYTSDEDIDEDFDTQLIIQQSLQDIYKPGTAQHAPKDESLHSFLSADYKKIVETIEKVGKEDALSHLT      1 - 70
KYHSAFGEADEIGWIPLHKAAVQLNRKILEITLSASDPSLWEQTTHNGETPLFLAVSSCLLENATFLLLN     71 - 140
GCNPNAKNFEGNSPLLAAVLRDCYDMAALLINYGADVNLRCANERTALHEAAKLGREDMVKLMLVSGAHP    141 - 210
DPQSTYGFTPLALAAQSGHTEIMEMLLRKGKIFCLASDSSSILLEAASGGNPDAVALLLEYGADANIPKN    211 - 280
SGHLPIHVAADRGHLLALKILIPVTDLAAIKQSGISPVHCAAAGAHPQCLELLIQAGFDVNFMLDQRINK    281 - 350
HYDDHRKSALYFAVSNSDLSSVKLLLSAGALPNQDPVNCLQIALRMGNYELISLLLRHGANVNYFCRVNP    351 - 420
LHFPSALQYTLKDEVMLRMLLNYGYDTERCFDCPHGDKVHPSYTVEGWTSTVIKDTKFCEVITLSWLQHL    421 - 490
SGKVVRVMLDYVDQVRICSKLKAVLQKQGIWSEIHFILTNPRSLKHLCRLKIRKCMGRLHLRCPVFMSFL    491 - 560
PLPNRLKAYVLYKEYDLYGQGIFTGTW                                               561 - 587
//

Text Mined References (6)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16325183 2005 ASB proteins interact with Cullin5 and Rbx2 to form E3 ubiquitin ligase complexes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12076535 2002 The SOCS box: a tale of destruction and degradation.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.