Property Summary

NCBI Gene PubMed Count 4
PubMed Score 25.64
PubTator Score 8.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma 1.100 2.4e-03
lung carcinoma -1.400 6.6e-04
medulloblastoma, large-cell 1.100 5.7e-04
non diabetic and post-ischemic heart fai... 1.800 1.7e-02
ovarian cancer 1.200 2.3e-10

AA Sequence

MDNYTSDEDIDEDFDTQLIIQQSLQDIYKPGTAQHAPKDESLHSFLSADYKKIVETIEKVGKEDALSHLT      1 - 70
KYHSAFGEADEIGWIPLHKAAVQLNRKILEITLSASDPSLWEQTTHNGETPLFLAVSSCLLENATFLLLN     71 - 140
GCNPNAKNFEGNSPLLAAVLRDCYDMAALLINYGADVNLRCANERTALHEAAKLGREDMVKLMLVSGAHP    141 - 210
DPQSTYGFTPLALAAQSGHTEIMEMLLRKGKIFCLASDSSSILLEAASGGNPDAVALLLEYGADANIPKN    211 - 280
SGHLPIHVAADRGHLLALKILIPVTDLAAIKQSGISPVHCAAAGAHPQCLELLIQAGFDVNFMLDQRINK    281 - 350
HYDDHRKSALYFAVSNSDLSSVKLLLSAGALPNQDPVNCLQIALRMGNYELISLLLRHGANVNYFCRVNP    351 - 420
LHFPSALQYTLKDEVMLRMLLNYGYDTERCFDCPHGDKVHPSYTVEGWTSTVIKDTKFCEVITLSWLQHL    421 - 490
SGKVVRVMLDYVDQVRICSKLKAVLQKQGIWSEIHFILTNPRSLKHLCRLKIRKCMGRLHLRCPVFMSFL    491 - 560
PLPNRLKAYVLYKEYDLYGQGIFTGTW                                               561 - 587
//

Text Mined References (6)

PMID Year Title