Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 9.58791758752542E-29
osteosarcoma 7933 0.00546027549655619


  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.081 0.005
lung carcinoma 1.200 0.000


Accession A6NK53 B2RN78 B2RN79 Q86WL8


  Ortholog (2)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG

AA Sequence

QTSHLQAHQRVHTGEKPYKCFVCGKGFSKSSLSSDSSESP                                  631 - 670

Text Mined References (7)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12743021 2003 Differential expansion of zinc-finger transcription factor loci in homologous human and mouse gene clusters.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.