Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 5.3e-08

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -3.135 5.3e-08

AA Sequence

MLRHLPSRLPVKMWGRTLEKQSWRDSSQTPPPCLIRRLDHIVMTVKSIKDTTMFYSKILGMEVMTFKEDR      1 - 70
KALCFGDQKFNLHEVGKEFEPKAAHPVPGSLDICLITEVPLEEMIQHLKACDVPIEEGPVPRTGAKGPIM     71 - 140
SIYFRDPDRNLIEVSNYISS                                                      141 - 160
//

Text Mined References (4)

PMID Year Title