Property Summary

NCBI Gene PubMed Count 8
PubMed Score 56.25
PubTator Score 144.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
psoriasis 6,685
tuberculosis 1,557

Synonym

Accession A6NK06 CAD
Symbols CAD
IRG1

Gene

 GO Component (1)

Gene RIF (9)

PMID Text
26872335 IRF1 is a transcriptional regulator of IRG1 in human macrophages.
26872335 We identified IRF1 as a transcriptional regulator of IRG1 expression in both human and mouse macrophages under inflammatory conditions.
26872335 IRG1/CAD associates with mitochondria in human macrophages under inflammatory conditions such as LPS and/or IFNg.
26872335 Taken together, the results show that IRG1 is expressed by human monocytes, macrophages and dendritic cells and that it is rapidly induced in both human and murine macrophages under inflammatory conditions such as LPS, TNFa and IFNg.
25216059 Findings revealed that IRG1 is a candidate oncogene that is amplified in glioma and is involved in novel mechanisms that influence glioma pathogenesis.
23610393 IRG1 links cellular metabolism with immune defense by catalyzing itaconic acid production
23610393 Irg1 gene encodes an enzyme synthesizing itaconic acid from the TCA cycle intermediate cisaconitate. Furthermore, our data also show that IRG1 mediated itaconic acid production contributes to the antimicrobial activity of macrophages.
23609450 inducible IRG1 promotes endotoxin tolerance by increasing A20 expression through ROS, indicating a new molecular mechanism regulating hypoinflammation of sepsis and endotoxin tolerance.
21424586 Results indicated that the IRG1 gene is differentially expressed in human fetal PBMCs and LPS-stimulated adult PBMCs.

AA Sequence

MMLKSITESFATAIHGLKVGHLTDRVIQRSKRMILDTLGAGFLGTTTEVFHIASQYSKIYSSNISSTVWG      1 - 70
QPDIRLPPTYAAFVNGVAIHSMDFDDTWHPATHPSGAVLPVLTALAEALPRSPKFSGLDLLLAFNVGIEV     71 - 140
QGRLLHFAKEANDMPKRFHPPSVVGTLGSAAAASKFLGLSSTKCREALAIAVSHAGAPMANAATQTKPLH    141 - 210
IGNAAKHGIEAAFLAMLGLQGNKQVLDLEAGFGAFYANYSPKVLPSIASYSWLLDQQDVAFKRFPAHLST    211 - 280
HWVADAAASVRKHLVAERALLPTDYIKRIVLRIPNVQYVNRPFPVSEHEARHSFQYVACAMLLDGGITVP    281 - 350
SFHECQINRPQVRELLSKVELEYPPDNLPSFNILYCEISVTLKDGATFTDRSDTFYGHWRKPLSQEDLEE    351 - 420
KFRANASKMLSWDTVESLIKIVKNLEDLEDCSVLTTLLKGPSPPEVASNSPACNNSITNLS             421 - 481
//

Text Mined References (9)

PMID Year Title
26872335 2016 Gene Regulatory Network Inference of Immunoresponsive Gene 1 (IRG1) Identifies Interferon Regulatory Factor 1 (IRF1) as Its Transcriptional Regulator in Mammalian Macrophages.
25216059 2014 Immune responsive gene 1, a novel oncogene, increases the growth and tumorigenicity of glioma.
25158072 2015 Cross-disorder genome-wide analyses suggest a complex genetic relationship between Tourette's syndrome and OCD.
25060954 2014 Salt-inducible kinase 3, SIK3, is a new gene associated with hearing.
23610393 2013 Immune-responsive gene 1 protein links metabolism to immunity by catalyzing itaconic acid production.
23609450 2013 Immune responsive gene 1 (IRG1) promotes endotoxin tolerance by increasing A20 expression in macrophages through reactive oxygen species.
21424586 2011 Expression profile of human immune-responsive gene 1 and generation and characterization of polyclonal antiserum.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12893884 2003 Progesterone regulation of the mammalian ortholog of methylcitrate dehydratase (immune response gene 1) in the uterine epithelium during implantation through the protein kinase C pathway.