Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
facioscapulohumeral dystrophy 286

Synonym

Accession A6NK02
Symbols TRIM75

Gene

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MAVAAALTGLQAEAKCSICLDYLSDPVTIECGHNFCRSCIQQSWLDLQELFPCPVCRHQCQEGHFRSNTQ      1 - 70
LGRMIEIAKLLQSTKSNKRKQEETTLCEKHNQPLSVFCKEDLMVLCPLCTQPPDHQGHHVRPIEKAAIHY     71 - 140
RKRFCSYIQPLKKQLADLQKLISTQSKKPLELREMVENQRQELSSEFEHLNQFLDREQQAVLSRLAEEEK    141 - 210
DNQQKLSANITAFSNYSATLKSQLSKVVELSELSELELLSQIKIFYESENESSPSIFSIHLKRDGCSFPP    211 - 280
QYSALQRIIKKFKVEIILDPETAHPNLIVSEDKKRVRFTKRKQKVPGFPKRFTVKPVVLGFPYFHSGRHF    281 - 350
WEIEVGDKSEWAIGICKDSLPTKARRPSSAQQECWRIELQDDGYHAPGAFPTPLLLEVKARAIGIFLDYE    351 - 420
MGEISFYNMAEKSHICTFTDTFTGPLRPYFYVGPDSQPLRICTGTVCE                          421 - 468
//

Text Mined References (3)

PMID Year Title
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
8744354 1996 Does this have a familiar RING?