Knowledge Summary

Patent

No data available

AA Sequence

MLLGSLWGRCHPGCCALFLILALLLDAVGLVLLLLGILAPLSSWDFFIYTGALILALSLLLWIIWYSLNI      1 - 70
EVSPEKLDL                                                                  71 - 79
//

Text Mined References (3)

PMID Year Title