Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MVLQENGYGVEEDIPTLLMAASSMDDLLAITGFNTCLSIVFYSGGMINNAIASLRNVCISLLAGIVLGFF      1 - 70
VRYFPSEDQKKITLKRGFLVLITFVSAVLGSQPIGLHGSGGLCTLVLHFIEWTKWSQEKMKVQKIITNVW     71 - 140
DIFQPLLFGLVGAEVSVSLLESNIVGISVSTLSLALCVRILNIYLLMCFAGFSFKEKIFIALAWMPKATV    141 - 210
QAVLGPLALETARVSTPHLETYAKDVMTVAFLAIMITAPNGALLMGILGPKMLTRHYDPSKIKLQLSTLE    211 - 280
HH                                                                        281 - 282
//

Text Mined References (1)

PMID Year Title
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.