Property Summary

NCBI Gene PubMed Count 5
PubMed Score 179.68
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Central nervous system disease 10 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 3.565 1.8
Laryngotracheitis 10 3.015 1.5

 GO Process (1)

AA Sequence

MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMCIYWLRQRQAPSSDSHHEFL      1 - 70
TLWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVVDFLP     71 - 140
TTAQPTKKSTLKKRVCRLPRPETQKGPLCSPVTLGLLVAGVLVLLVSLGVAMHLCCRRRRARLRFMKQLY    141 - 210
K//

Text Mined References (6)

PMID Year Title