Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.5e-09
Disease Target Count Z-score Confidence
Asthma 385 0.0 3.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.900 1.5e-09

Gene RIF (1)

AA Sequence

MRMTSSSFVSYCTPGLCQFMAMLPTAGHLLPLLLVIGTGGTVPSPQVPPRGCYVAKEAGERTFRCSQAGL      1 - 70
SAVPSGIPNDTRKLYLDANQLASVPAGAFQHLPVLEELDLSHNALAHLSGAAFQGLEGTLRHLDLSANQL     71 - 140
ASVPVEAFVGLQIQVNLSANPWHCDCALQEVLRQVRLVPGTGTGIVCGSGARPDLVGQEFLLLAGEEELC    141 - 210
GSGWGGARRSTDVALLVTMGGWLTLMVAYLVHYVWQNRDETRRSLKRAPVLPVRSEDSSILSTVV         211 - 275
//

Text Mined References (5)

PMID Year Title