Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 3.5e-10
posterior fossa group B ependymoma 416 4.8e-04

Expression

  Differential Expression (2)

Disease log2 FC p
posterior fossa group B ependymoma 1.100 4.8e-04
psoriasis -1.200 3.5e-10

AA Sequence

MASRSAGTLLTEFNAAYVPPGLMPGYQGHVPTVAFSFGAPYGTTTLKYFQDHRNRAMEKSHTPFSQGGHF      1 - 70
PTIFSTNPNLLLMERASTRDRWLHKPSYTRFNLDSHRSTELTNFYQMVQQHRKYYQDKTGTVPRVPYFAM     71 - 140
PVREPERYPLPTVLPPLCPKKKWHLLRLAPENLKTYQTFPSGKRVSPQERKKRDCYFEFRA             141 - 201
//

Text Mined References (3)

PMID Year Title