Property Summary

NCBI Gene PubMed Count 7
PubMed Score 11.62
PubTator Score 0.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Kidney disease 430 0.0 3.0
Disease Target Count Z-score Confidence
spina bifida 1074 3.338 1.7
ventricular septal defect 20 3.293 1.6

Expression

AA Sequence

MMDGRLLEHPHAQFGGSLGGVVGFPYPLGHHHVYELAGHQLQSAAAAASVPFSIDGLLGGSCAAAASVVN      1 - 70
PTPLLPAACGVGGDGQPFKLSDSGDPDKESPGCKRRRTRTNFTGWQLEELEKAFNESHYPDVFMREALAL     71 - 140
RLDLVESRVQVWFQNRRAKWRKKENTKKGPGRPAHNSHPTTCSGEPMDPEEIARKELEKMEKKKRKHEKK    141 - 210
LLKSQGRHLHSPGGLSLHSAPSSDSDSGGGGLSPEPPEPPPPAAKGPGAHASGAAGTAPAPPGEPPAPGT    211 - 280
CDPAFYPSQRSGAGPQPRPGRPADKDAASCGPGAAVAAVERGAAGLPKASPFSVESLLSDSPPRRKAASN    281 - 350
AAAAAAAGLDFAPGLPCAPRTLIGKGHFLLYPITQPLGFLVPQAALKGGAGLEPAPKDAPPAPAVPPAPP    351 - 420
AQASFGAFSGPGGAPDSAFARRSPDAVASPGAPAPAPAPFRDLASAAATEGGGGDCADAGTAGPAPPPPA    421 - 490
PSPRPGPRPPSPAEEPATCGVPEPGAAAGPSPPEGEELDMD                                 491 - 531
//

Text Mined References (7)

PMID Year Title