Knowledge Summary

Patent

No data available

Synonym

Accession A6NJR5
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MQKHYTVAWFLYSAPGVDPSPPCRSLGWKRKKEWSDESEEEPEKELAPEPEETWVVEMLCGLKMKLKQQR      1 - 70
VSPILPEHHKDFNSQLAPGVDPSPPHRSFCWKRKREWWDESEESLEEEPRKVLAPEPEEIWVAEMLCGLK     71 - 140
MKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFL    141 - 210
ALYLANDMEEDDEDPKQNIFYFLYGKTRSRIPLIALFQKLRFQFFCSMSGRAWVSREELEEIQAYDPEHW    211 - 280
VWARDRARLS                                                                281 - 290
//

Text Mined References (1)

PMID Year Title
12853948 2003 The DNA sequence of human chromosome 7.