Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.100 0.010
facioscapulohumeral dystrophy 3.200 0.000

AA Sequence

MAANWTLSWGQGGPCNSPGSDTPRSVASPETQLGNHDRNPETWHMNFRMFSCPEESDPIQALRKLTELCH      1 - 70
LWLRPDLHTKEQILDMLVMEQFMISMPQELQVLVKVNGVQSCKDLEDLLRNNRRPKKWSIVNLLGKEYLM     71 - 140
LNSDVEMAEAPASVRDDPRDVSSQWASSVNQMHPGTGQARREQQILPRVAALSRRQGEDFLLHKSIDVTG    141 - 210
DPNSPRPKQTLEKDLKENREENPGLSSPEPQLPKSPNLVRAKEGKEPQKRASVENVDADTPSACVVEREA    211 - 280
LTHSGNRGDALNLSSPKRSKPDASSISQEEPQGEATPVGNRESPGQAEINPVHSPGPAGPVSHPDGQEAK    281 - 350
ALPPFACDVCNKSFKYFSQLSIHRRSHTGDRPFQCDLCRKRFLQPSDLRVHQRVHTGERPYMCDVCQKRF    351 - 420
AHESTLQGHKRIHTGERPFKCKYCSKVFSHKGNLNVHQRTHSGEKPYKCPTCQKAFRQLGTFKRHLKTHR    421 - 490
ETTSQ                                                                     491 - 495
//

Text Mined References (2)

PMID Year Title
15057824 2004 The DNA sequence and biology of human chromosome 19.
11181995 2001 The sequence of the human genome.