Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.60
PubTator Score 2.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 3.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

AA Sequence

MRNRMAPENPQPDPFINRNYSNMKVIPPQDPASPSFTLLSKLECSGTVSAYCSLNLPGSTDPPTSASRVA      1 - 70
ATTAIRRRHKERTSFTHQQYEELEALFSQTMFPDRNLQEKLALRLDLPESTVKVWFRNRRFKLKKQQQQQ     71 - 140
SAKQRNQILPSKKNVPTSPRTSPSPYAFSPVISDFYSSLPSQPLDPSNWAWNSTFTESSTSDFQMQDTQW    141 - 210
ERLVASVPALYSDAYDIFQIIELYNLPDENEISSSSFHCLYQYLSPTKYQVGGQGSSLSIFAGPAVGLSP    211 - 280
AQTWPNMTSQAFEAYSLTDSLEFQKTSNMVDLGFL                                       281 - 315
//

Text Mined References (3)

PMID Year Title