Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.60
PubTator Score 2.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
facioscapulohumeral dystrophy 286

AA Sequence

MRNRMAPENPQPDPFINRNYSNMKVIPPQDPASPSFTLLSKLECSGTVSAYCSLNLPGSTDPPTSASRVA      1 - 70
ATTAIRRRHKERTSFTHQQYEELEALFSQTMFPDRNLQEKLALRLDLPESTVKVWFRNRRFKLKKQQQQQ     71 - 140
SAKQRNQILPSKKNVPTSPRTSPSPYAFSPVISDFYSSLPSQPLDPSNWAWNSTFTESSTSDFQMQDTQW    141 - 210
ERLVASVPALYSDAYDIFQIIELYNLPDENEISSSSFHCLYQYLSPTKYQVGGQGSSLSIFAGPAVGLSP    211 - 280
AQTWPNMTSQAFEAYSLTDSLEFQKTSNMVDLGFL                                       281 - 315
//

Text Mined References (3)

PMID Year Title
20565723 2010 The origin and evolution of ARGFX homeobox loci in mammalian radiation.
17005330 2007 Annotation, nomenclature and evolution of four novel homeobox genes expressed in the human germ line.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.