Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A6NJG2
Symbols ANKRD58

Gene

 Compartment GO Term (0)

AA Sequence

MAQLGGAANRAPTASLAPTSQSLRCAPQPRPSRADTGSLGRYWGKAAAAASREHPFPGTLMHSAAGSGRR      1 - 70
RGALRELLGLQRAAPAGWLSEERAEELGGPSGPGSSRLCLEPREHAWILAAAEGRYEVLRELLEAEPELL     71 - 140
LRGDPITGYSVLHWLAKHGRHEELILVHDFALRRGLRLDVSAPGSGGLTPLHLAALQGHDMVIKVLVGAL    141 - 210
GADATRRDHSGHRACHYLRPDAPWRLRELSGAEEWEMESGSGCTNLNNNSSGTTAWRAASAVGATAVETS    211 - 280
RRVAASRTKAKDTAGSRVAQMHSLFRHLFPSFQDR                                       281 - 315
//

Text Mined References (2)

PMID Year Title
22234889 2012 An ancient genomic regulatory block conserved across bilaterians and its dismantling in tetrapods by retrogene replacement.
15772651 2005 The DNA sequence of the human X chromosome.