Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.07

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MDTQGPVSQPFQQPEKPGRVRRRKTRRERNKALVGSRRPLAHHDPPVAIRDPPVVPTASKLVVITQGRLS      1 - 70
REHRGLFNHEVKSLDVARLLSSGTLVPGSPTLPAKPSPSPGRAQEPAPRSRDKENQVPGGSGPGPPSSPE     71 - 140
LSGVGQLLAELQCQLSLPQAFPRRNLIQDARDAIVHTLQACHGCVPDLALVLRGCQPPLPGAKPGVSERK    141 - 210
MTPFWINSPDQVPEQERQRKQQGTKEFTFPMPYTSSMPTAHRGSLAPPRGPWPPYFPSLSSPSGTAWGPP    211 - 280
TAFDLLKSIWLVATPPPPRPWGVGLPQPLPQPSSPLLPRTSVLDWSPSPPSPLPSLSWVVAQSSPEAWSF    281 - 350
PPMRLY                                                                    351 - 356
//

Text Mined References (6)

PMID Year Title