Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NJ88
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MYSQEDHIFQLCSTDLCASYVPVINQSVLVTHIVNYEDYLQIQASPLQTSQPTPPEELHTVGYVFTNDGQ      1 - 70
QTRSDEVNQVATGHQSKQKRSRESKRHSSSKRRKSMSRWLNKQEDAAVTHIVCEEKINNDQPAPDNVLST     71 - 140
APPWLRDMAAAGISSTSTRDLYATVTHNVCDERMENDQLQLNNVLLTFPPERVNMAVADFSAMSPRDLYA    141 - 210
TINHNVYEVRMENNQPQFNNVLSTVKPGHINMAAAGIPAMSAKDAVVNLNVHGEKINKGQPAPDNFLSSV    211 - 280
TPGLINVSGDGATVTHNAYEEKMENGQQAADNILSAVPPGLINTSEAGIPAMSTNDLYATITHDVSEKKI    281 - 350
KNSQPATDNFLCTVTPGLINLAEAGILATSTRDLYDTATHNVHEEKMKNKHLITPCQQFHWDLLICQELL    351 - 420
NFFIWIPDATVIHNIQEEEMENGQMPPDGFLSNSAPLELINMTEDCMPLNALDSFSYDFTSLSREELLYK    421 - 490
HDSNEFAVGTKNYSVSAGDPPVTAMSSVETPQISPAMAKKINQDIKCQLMKEVQRFGQNYKRIFILLEEL    491 - 560
QGSMKVKRQFVEFTIREAVRFKKVALIQQLEKVLKEIDSHCHLRKVKHMRKKIIVI                  561 - 616
//

Text Mined References (1)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.