Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCVVSGGSISSSNWWSWVRQPPGKGLEWIGE      1 - 70
IYHSGSPNYNPSLKSRVTISVDKSKNQFSLKLSSVTAADRAVYYCARDTVRGG                      71 - 123
//

Text Mined References (2)

PMID Year Title
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
7951227 1994 Human immunoglobulin VH and D segments on chromosomes 15q11.2 and 16p11.2.