Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

 GO Process (1)

AA Sequence

MREYKLVVLGSRGVGKSALTVQFVQGIFVEKYDPTIEDSYREQVEVDAQQCMLEILDTAGTEQFTAMRDL      1 - 70
YMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNN     71 - 140
CAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL                              141 - 184
//

Text Mined References (1)

PMID Year Title