Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Depersonalization disorder 4 3.857 1.9
Cancer 2346 3.235 1.6

Synonym

Accession A6NIZ1
Symbols

Gene

AA Sequence

MREYKLVVLGSRGVGKSALTVQFVQGIFVEKYDPTIEDSYREQVEVDAQQCMLEILDTAGTEQFTAMRDL      1 - 70
YMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNN     71 - 140
CAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL                              141 - 184
//

Text Mined References (1)

PMID Year Title
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.