Property Summary

NCBI Gene PubMed Count 13
Grant Count 8
R01 Count 4
Funding $201,456.87
PubMed Score 56.72
PubTator Score 9.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Gene RIF (8)

PMID Text
27033705 Nck1 and Nck2 Interact with WTIP. Nck1/2 integrates nephrin with the Hippo kinase cascade through association with the adaptor protein WTIP.
25065743 WTIP interacts with ASXL2 and blocks ASXL2-mediated activation of retinoic acid signaling.
21900451 Wtip regulates the stable formation of cell adhesions to both extracellular matrix and neighboring cells and suggest that Wtip is necessary for normal glomerular filtration barrier function
21686224 Report role of WTIP in regulating podocyte phenotype in chronic kidney disease.
20086015 Stress signaling pathways initiate WTIP nuclear translocation, and the concomitant loss of WTIP from cell contacts changes podocyte morphology and dynamic actin assembly, suggesting a mechanism that transmits changes in podocyte morphology to the nucleus.
19785987 Full-length Ror2 recruits Wtip to the cell membrane, a mutant involved in human disease fails to do so. Both genes and proteins show overlapping expression in the mouse embryo.
18331720 WTIP is a member of the Ajuba family of LIM-domain containing proteins. Ajuba LIM proteins co-repress E-cadherin expression through interaction with the SNAG domain of Snail/Slug and promote epithelial to mesenchymal differentiation in a Xenopus model.
14736876 WTIP monitors slit diaphragm protein assembly as part of a multiple protein complex, linking this specialized adhesion junction to the actin cytoskeleton, and shuttles into the nucleus after podocyte injury

AA Sequence

MQRSRAGADEAALLLAGLALRELEPGCGSPGRGRRGPRPGPGDEAAPALGRRGKGSGGPEAGADGLSRGE      1 - 70
RGPRRAAVPELSAQPAGSPRASLAGSDGGGGGGSARSSGISLGYDQRHGSPRSGRSDPRPGPGPPSVGSA     71 - 140
RSSVSSLGSRGSAGAYADFLPPGACPAPARSPEPAGPAPFPLPALPLPPGREGGPSAAERRLEALTRELE    141 - 210
RALEARTARDYFGICIKCGLGIYGAQQACQAMGSLYHTDCFTCDSCGRRLRGKAFYNVGEKVYCQEDFLY    211 - 280
SGFQQTADKCSVCGHLIMEMILQALGKSYHPGCFRCSVCNECLDGVPFTVDVENNIYCVRDYHTVFAPKC    281 - 350
ASCARPILPAQGCETTIRVVSMDRDYHVACYHCEDCGLQLSGEEGRRCYPLAGHLLCRRCHLRRLQPGPL    351 - 420
PSPTVHVTEL                                                                421 - 430
//

Text Mined References (14)

PMID Year Title
27033705 2016 Nephrin Suppresses Hippo Signaling through the Adaptor Proteins Nck and WTIP.
25065743 2014 WTIP interacts with ASXL2 and blocks ASXL2-mediated activation of retinoic acid signaling.
22286099 2012 The LIMD1 protein bridges an association between the prolyl hydroxylases and VHL to repress HIF-1 activity.
21900451 2012 WT1-interacting protein (Wtip) regulates podocyte phenotype by cell-cell and cell-matrix contact reorganization.
21834987 2011 Identification and characterization of a set of conserved and new regulators of cytoskeletal organization, cell morphology and migration.
21686224 2011 Out on a LIM: chronic kidney disease, podocyte phenotype and the Wilm's tumor interacting protein (WTIP).
20616046 2010 LIM-domain proteins, LIMD1, Ajuba, and WTIP are required for microRNA-mediated gene silencing.
20303269 2010 Ajuba LIM proteins are negative regulators of the Hippo signaling pathway.
20086015 2010 Podocyte injury induces nuclear translocation of WTIP via microtubule-dependent transport.
19785987 2009 The LIM domain protein Wtip interacts with the receptor tyrosine kinase Ror2 and inhibits canonical Wnt signalling.
More...