Property Summary

NCBI Gene PubMed Count 14
PubMed Score 59.41
PubTator Score 9.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Gene RIF (9)

AA Sequence

MQRSRAGADEAALLLAGLALRELEPGCGSPGRGRRGPRPGPGDEAAPALGRRGKGSGGPEAGADGLSRGE      1 - 70
RGPRRAAVPELSAQPAGSPRASLAGSDGGGGGGSARSSGISLGYDQRHGSPRSGRSDPRPGPGPPSVGSA     71 - 140
RSSVSSLGSRGSAGAYADFLPPGACPAPARSPEPAGPAPFPLPALPLPPGREGGPSAAERRLEALTRELE    141 - 210
RALEARTARDYFGICIKCGLGIYGAQQACQAMGSLYHTDCFTCDSCGRRLRGKAFYNVGEKVYCQEDFLY    211 - 280
SGFQQTADKCSVCGHLIMEMILQALGKSYHPGCFRCSVCNECLDGVPFTVDVENNIYCVRDYHTVFAPKC    281 - 350
ASCARPILPAQGCETTIRVVSMDRDYHVACYHCEDCGLQLSGEEGRRCYPLAGHLLCRRCHLRRLQPGPL    351 - 420
PSPTVHVTEL                                                                421 - 430
//

Text Mined References (15)

PMID Year Title