Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.11
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Celiac disease 116 0.0 1.7

Expression

Synonym

Accession A6NIV6
Symbols LRRC64

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSKDIKSVEHSPKIHQRNDPQHVNDRTFFIDASNQSLTAIPLEIFTFTELEEVHLENNQIEEIPQEIQRL      1 - 70
KNIRVLYLDKNNLRSLCPALGLLSSLESLDLSYNPIFSSSLVVVSFLHALRELRLYQTDLKEIPVVIFKN     71 - 140
LHHLELLGLTGNHLKCLPKEIVNQTKLREIYLKRNQFEVFPQELCVLYTLEIIDLDENKIGAIPEEIGHL    141 - 210
TGLQKFYMASNNLPVLPASLCQCSQLSVLDLSHNLLHSIPKSFAELRKMTEIGLSGNRLEKVPRLICRWT    211 - 280
SLHLLYLGNTGLHRLRGSFRCLVNLRFLDLSQNHLHHCPLQICALKNLEVLGLDDNKIGQLPSELGSLSK    281 - 350
LKILGLTGNEFLSFPEEVLSLASLEKLYIGQDQGFKLTYVPEHIRKLQSLKELYIENNHLEYLPVSLGSM    351 - 420
PNLEVLDCRHNLLKQLPDAICQAQALKELRLEDNLLTHLPENLDSLVNLKVLTLMDNPMEEPPKEVCAEG    421 - 490
NEAIWKYLKENRNRNIMATKIQAWWRGTMVQRGFGKFGELLKPQKKGKTSPKDKKGKKDVKGKPGKGKKK    491 - 560
//

Text Mined References (5)

PMID Year Title