Property Summary

NCBI Gene PubMed Count 1
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 5.7163875226873E-29
nasopharyngeal carcinoma 1056 5.17350871284718E-8
posterior fossa group B ependymoma 1530 2.45157005737305E-5
pilocytic astrocytoma 3086 4.42287377889083E-5
group 3 medulloblastoma 2254 5.95034525421136E-4
pituitary cancer 1972 0.0010923068401118

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma -1.600 0.001
pilocytic astrocytoma -1.200 0.000
posterior fossa group B ependymoma 1.500 0.000
nasopharyngeal carcinoma -1.900 0.000
pituitary cancer -1.700 0.001
psoriasis -1.600 0.000

AA Sequence

MGIAESTPDELPSDAEEQLRSGDQQLELSGRRLRRLPSAVCALSRLQKLYVSGTGLRELPEEIEELRELR      1 - 70
ILALDFNKLERLPDGLCRLPRLTRLYLGGNRLLALPADFAQLQSLRCLWIEGNFLRRFPRPLLRLVALQS     71 - 140
LQMGDNRLRALPAELPRMTGLRGLWLYGNRFEEFPPALLRMGRLHILDLDRNRLGGFPDLHPLRALRVFS    141 - 210
YDHNPVTGPPRVADTVFLVGEGAVERMAERDEPTPRPPPRRPARAFEDEEEEDLLIGGAGSRALGAPGGS    211 - 280
FRALEAAPGLGT                                                              281 - 292
//

Text Mined References (1)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.