Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
Astrocytoma, Pilocytic -1.200 6.6e-05
group 3 medulloblastoma -1.600 6.0e-04
nasopharyngeal carcinoma -1.900 5.2e-08
pituitary cancer -1.700 1.1e-03
posterior fossa group B ependymoma 1.500 2.5e-05
psoriasis -1.600 5.7e-29

Gene RIF (1)

AA Sequence

MGIAESTPDELPSDAEEQLRSGDQQLELSGRRLRRLPSAVCALSRLQKLYVSGTGLRELPEEIEELRELR      1 - 70
ILALDFNKLERLPDGLCRLPRLTRLYLGGNRLLALPADFAQLQSLRCLWIEGNFLRRFPRPLLRLVALQS     71 - 140
LQMGDNRLRALPAELPRMTGLRGLWLYGNRFEEFPPALLRMGRLHILDLDRNRLGGFPDLHPLRALRVFS    141 - 210
YDHNPVTGPPRVADTVFLVGEGAVERMAERDEPTPRPPPRRPARAFEDEEEEDLLIGGAGSRALGAPGGS    211 - 280
FRALEAAPGLGT                                                              281 - 292
//

Text Mined References (2)

PMID Year Title