Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MPTTPDPGSEPPARTPRPPPLTPGLSPQPALHALSPQLLLLLFLAVSSLGSCSTGSPVPVPENDLVGIVG      1 - 70
GHNAPPGKWPWQVSLRVYSYHWASWAHICGGSLIHPQWVLTAAHCIFWKDTDPSIYRIHAGDVYLYGGRG     71 - 140
LLNVSRIIVHPNYVTAGLGADVALLQLEPHDLSNVRTVKLSPVSLELTPKDQCWVTGWGAIIRKESLPPP    141 - 210
YRLQQASVQVLENAVCEQPYRNASGHTGDRQLILDDMLCAGSEGRDSCYGDSGGPLVCRLRGSWRLVGVV    211 - 280
SWGYGCTLRDFPGVYTHVQIYVPWILQQVGELP                                         281 - 313
//

Text Mined References (3)

PMID Year Title
17947681 2007 Mast cell alpha and beta tryptases changed rapidly during primate speciation and evolved from gamma-like transmembrane peptidases in ancestral vertebrates.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.