Property Summary

NCBI Gene PubMed Count 1
PubMed Score 12.48

Knowledge Summary

Patent

No data available

Synonym

Accession A6NI87
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MWASRDHLPEPDLGDAAPPGSPSSFWTSGLPRQERSTSRQRSRGSPSSTCVPYKVHALATFECSATSHAS      1 - 70
RLWQTLQQFWADHISRPFSPRRPPLRRMPSLSTFYLLDHNTRQAELGLAYGAPCMRLSNQAFVFRGGRWT     71 - 140
TESQLARTRSPLLSRTAWGWKAQVQRSKSQVLLEENNYLKLQQELLIDMLTETMARMHLLEKQRNPEVIP    141 - 210
TAAARAGQRKMRKRAGASAGVLMIQPCALDSQ                                          211 - 242
//

Text Mined References (1)

PMID Year Title
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.