Property Summary

NCBI Gene PubMed Count 1
PubMed Score 12.48

Knowledge Summary


No data available


AA Sequence

TAAARAGQRKMRKRAGASAGVLMIQPCALDSQ                                          211 - 242

Text Mined References (1)

PMID Year Title