Property Summary

NCBI Gene PubMed Count 6
Grant Count 2
Funding $285,851.31
PubMed Score 14.97
PubTator Score 13.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
tuberculosis and treatment for 6 months 1.100 0.000
Multiple Sclerosis 1.100 0.037
lung carcinoma -1.300 0.000
mucosa-associated lymphoid tissue lympho... 2.349 0.006
ulcerative colitis 1.300 0.005
psoriasis 2.100 0.000

Synonym

Accession A6NI73 A6NHI3
Symbols CD85
LIR9
CD85F
ILT11
LIR-9
ILT-11
LILRB7

Gene

 Grant Application (2)

PDB

2D3V  

Gene RIF (2)

PMID Text
20331378 Observational study of gene-disease association. (HuGE Navigator)
16675463 LILRA5/LIR9/ILT11 does not play a role in any MHCI recognition but could possibly bind to non-MHCI ligand(s) on the target cells to provide a novel immune regulation mechanism

AA Sequence

MAPWSHPSAQLQPVGGDAVSPALMVLLCLGLSLGPRTHVQAGNLSKATLWAEPGSVISRGNSVTIRCQGT      1 - 70
LEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYN     71 - 140
KPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRW    141 - 210
MLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIRMGMAGLILVVLG    211 - 280
ILIFQDWHSQRSPQAAAGR                                                       281 - 299
//

Text Mined References (7)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
19658091 2009 Alternative mRNA splicing creates transcripts encoding soluble proteins from most LILR genes.
16675463 2006 Crystal structure of the human monocyte-activating receptor, "Group 2" leukocyte Ig-like receptor A5 (LILRA5/LIR9/ILT11).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12393390 2003 LIR9, an immunoglobulin-superfamily-activating receptor, is expressed as a transmembrane and as a secreted molecule.
10941842 2000 Extensive gene duplications and a large inversion characterize the human leukocyte receptor cluster.