Property Summary

NCBI Gene PubMed Count 6
PubMed Score 16.06
PubTator Score 13.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Arthritis, Juvenile 126 0.0 0.0
Disease Target Count
Juvenile arthritis 126
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (6)

Disease log2 FC p
lung carcinoma -1.300 1.1e-10
mucosa-associated lymphoid tissue lympho... 2.349 6.1e-03
Multiple Sclerosis 1.100 3.7e-02
psoriasis 2.100 9.2e-35
tuberculosis and treatment for 6 months 1.100 9.2e-06
ulcerative colitis 1.300 4.5e-03

Gene RIF (2)

AA Sequence

MAPWSHPSAQLQPVGGDAVSPALMVLLCLGLSLGPRTHVQAGNLSKATLWAEPGSVISRGNSVTIRCQGT      1 - 70
LEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYN     71 - 140
KPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRW    141 - 210
MLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIRMGMAGLILVVLG    211 - 280
ILIFQDWHSQRSPQAAAGR                                                       281 - 299
//

Text Mined References (7)

PMID Year Title