Property Summary

NCBI Gene PubMed Count 0
Grant Count 2
R01 Count 2
Funding $693,547
PubMed Score 6.86
PubTator Score 1.98

Knowledge Summary

Patent

No data available

AA Sequence

MGTLVAKLLLPTLSSLAFLPTVSIAAKRRFHMEAMVYLFTLFFVALHHACNGPGLSVLCFMRHDILEYFS      1 - 70
VYGTALSMWVSLMALADFDEPKRSTFVMFGVLTIAVRIYHDRWGYGVYSGPIGTAILIIAAKWLQKMKEK     71 - 140
KGLYPDKSVYTQQIGPGLCFGALALMLRFFFEDWDYTYVHSFYHCALAMSFVLLLPKVNKKAGSPGTPAK    141 - 210
LDCSTLCCACV                                                               211 - 221
//

Text Mined References (1)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.