Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Osteopetrosis 43 3.847 1.9

Expression

Synonym

Accession A6NI56 G9JV18
Symbols C16orf29

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MSELADSGPSGASAPSQLRAVTLEDLGLLLAGGLASPEPLSLEELSERYESSHPTSTASVPEQDTAKHWN      1 - 70
QLEQWVVELQAEVACLREHKQRCERATRSLLRELLQVRARVQLQGSELRQLQQEARPAAQAPEKEAPEFS     71 - 140
GLQNQMQALDKRLVEVREALTRLRRRQVQQEAERRGAEQEAGLRLAKLTDLLQQEEQGREVACGALQKNQ    141 - 210
EDSSRRVDLEVARMQAQVTKLGEEVSLRFLKREAKLCGFLQKSFLALEKRMKASESSRLKLEGSLRGELE    211 - 280
SRWEKLRGLMEERLRALQGQHEVGPGGRRAEESHLLEQCQGLDAAVAQLTKFVQQNQASLNRVLLAEEKA    281 - 350
WDAKGRLEESRAGELAAYVQENLEAAQLAGELARQEMHGELVLLREKSRALEASVAQLAGQLKELSGHLP    351 - 420
ALSSRLDLQEQMLGLRLSEAKTEWEGAERKSLEDLARWRKEVTEHLRGVREKVDGLPQQIESVSDKCLLH    421 - 490
KSDSDLRISAEGKAREFKVGALRQELATLLSSVQLLKEDNPGRKIAEMQGKLATNQIMKLENCVQANKTI    491 - 560
QNLRFNTEARLRTQEMATLWESVLRLWSEEGPRTPLGSWKALPSLVRPRVFIKDMAPGKVVPMNCWGVYQ    561 - 630
AVRWLRWKASLIKLRALRRPGGVLEKPHSQEQVQQLTPSLFIQK                              631 - 674
//

Text Mined References (3)

PMID Year Title