Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.50
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NI47
Symbols ACT
P704P
POTE14beta

Gene

 Compartment GO Term (0)

AA Sequence

MVAEAGSMPAASSVKKPFGLRSKMGKWCRHCFPWCRGSGKSNVGTSGDHDDSAMKTLRSKMGKWCRHCFP      1 - 70
WCRGSGKSNVGTSGDHDDSAMKTLRSKMGKWCCHCFPCCRGSGKSKVGPWGDYDDSAFMEPRYHVRREDL     71 - 140
DKLHRAAWWGKVPRKDLIVMLKDTDMNKKDKQKRTALHLASANGNSEVVKLLLDRRCQLNILDNKKRTAL    141 - 210
TKAVQCQEDECALMLLEHGTDPNIPDEYGNTALHYAIYNEDKLMAKALLLYGADIESKNKHGLTPLLLGV    211 - 280
HEQKQQVVKFLIKKKANLNALDRYGRTVLILAVCCGSASIVSLLLEQNIDVSSQDLSGQTAREYAVSSRH    281 - 350
NVICQLLSDYKEKQILKVSSENSNPEQDLKLTSEEESQRLKGSENSQPEEMSQEPEINKGGDRKVEEEMK    351 - 420
KHGSTHMGFPENLPNGATADNGDDGLIPPRKSRTPESQQFPDTENEQYHSDEQNDTQKQLSEEQNTGILQ    421 - 490
DEILIHEEKQIEVAENEF                                                        491 - 508
//

Text Mined References (4)

PMID Year Title
16824795 2006 Identification of a novel actin isoform in hepatocellular carcinoma.
16364570 2006 Duplication and extensive remodeling shaped POTE family genes encoding proteins containing ankyrin repeat and coiled coil domains.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.