Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.64
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A6NI47
Symbols ACT
P704P
POTE14beta

Gene

 Compartment GO Term (1)

AA Sequence

MVAEAGSMPAASSVKKPFGLRSKMGKWCRHCFPWCRGSGKSNVGTSGDHDDSAMKTLRSKMGKWCRHCFP      1 - 70
WCRGSGKSNVGTSGDHDDSAMKTLRSKMGKWCCHCFPCCRGSGKSKVGPWGDYDDSAFMEPRYHVRREDL     71 - 140
DKLHRAAWWGKVPRKDLIVMLKDTDMNKKDKQKRTALHLASANGNSEVVKLLLDRRCQLNILDNKKRTAL    141 - 210
TKAVQCQEDECALMLLEHGTDPNIPDEYGNTALHYAIYNEDKLMAKALLLYGADIESKNKHGLTPLLLGV    211 - 280
HEQKQQVVKFLIKKKANLNALDRYGRTVLILAVCCGSASIVSLLLEQNIDVSSQDLSGQTAREYAVSSRH    281 - 350
NVICQLLSDYKEKQILKVSSENSNPEQDLKLTSEEESQRLKGSENSQPEEMSQEPEINKGGDRKVEEEMK    351 - 420
KHGSTHMGFPENLPNGATADNGDDGLIPPRKSRTPESQQFPDTENEQYHSDEQNDTQKQLSEEQNTGILQ    421 - 490
DEILIHEEKQIEVAENEF                                                        491 - 508
//

Text Mined References (4)

PMID Year Title